PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.16G023800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family NAC
Protein Properties Length: 363aa    MW: 39814.6 Da    PI: 9.1961
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.16G023800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1744.4e-54151421128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                          lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk
  Manes.16G023800.1.p  15 LPPGFRFHPTDEELVVHYLKKKAASAPLPV-TIIAEVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDK 103
                          79****************************.89***************8888999*********************************** PP

                  NAM  91 evlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                          ++ls+ ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  Manes.16G023800.1.p 104 PILSSnGNQKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 142
                          ***9967788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-6510179IPR003441NAC domain
PROSITE profilePS5100562.44715179IPR003441NAC domain
PfamPF023654.3E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MESTDSSSGS HHPQLPPGFR FHPTDEELVV HYLKKKAASA PLPVTIIAEV DLYKFDPWEL  60
PSKATFGEQE WYFFSPRDRK YPNGARPNRA ATSGYWKATG TDKPILSSNG NQKVGVKKAL  120
VFYGGKPPKG IKTNWIMHEY RLVDNNNNTS SSKPPCVDSA NKKGSLRLDD WVLCRIYKKN  180
NSQRPMEREK EDSMEALLSS VAAHPKLPAA SKPTAFVSVL DQNEENFFEG ILTGNDGMQN  240
SSNIISQLLS SNTKPHIFIP PSVSTSYTLA AKRLLPSQYW NEAPAAAAAA TGSSMGASSG  300
NKRFHGDLNS CSTATDQDNT SFVSLLSQLP QSTPFHPNTF LGSLGDGVLR QQFQLPSMNW  360
NS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-761518217168NO APICAL MERISTEM PROTEIN
1ut4_B2e-761518217168NO APICAL MERISTEM PROTEIN
1ut7_A2e-761518217168NO APICAL MERISTEM PROTEIN
1ut7_B2e-761518217168NO APICAL MERISTEM PROTEIN
4dul_A2e-761518217168NAC domain-containing protein 19
4dul_B2e-761518217168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR6052210.0KR605221.1 Manihot esculenta NAC transcription factors 83 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002519008.10.0PREDICTED: NAC transcription factor 25
SwissprotQ8GY421e-125NAC25_ARATH; NAC transcription factor 25
TrEMBLA0A0M3R8650.0A0A0M3R865_MANES; NAC transcription factors 83
STRINGPOPTR_0011s04650.11e-176(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-124NAC domain containing protein 25
Publications ? help Back to Top
  1. Hu W, et al.
    Genome-Wide Identification and Expression Analysis of the NAC Transcription Factor Family in Cassava.
    PLoS ONE, 2015. 10(8): p. e0136993
    [PMID:26317631]